(data stored in ACNUC29543 zone)

EMBL: CP001044.PE303

CP001044.PE303       Location/Qualifiers
FT   CDS             345493..346017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpe:BP0507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3418"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72572"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL43"
FT                   /protein_id="ACC72572.1"
FT                   /translation="MLDFIRHPVRILHLNVRTEVHGDEERTAVDIKLGFDLPNRALDKL
FT                   SPSLRASLYEVLDDPNLPVLGPDGQHLTHVKNPQLGTLKWAGEYAPVGLHFHTGNGRSA
FT                   KGDLLFPEATFGKLAITAKEGGTCACVARAQILPNPDETAKLVGLLKHEIPATLDSAGA
FT                   VDTEVEGADDE"
     MLDFIRHPVR ILHLNVRTEV HGDEERTAVD IKLGFDLPNR ALDKLSPSLR ASLYEVLDDP        60
     NLPVLGPDGQ HLTHVKNPQL GTLKWAGEYA PVGLHFHTGN GRSAKGDLLF PEATFGKLAI       120
     TAKEGGTCAC VARAQILPNP DETAKLVGLL KHEIPATLDS AGAVDTEVEG ADDE             174
//

If you have problems or comments...

PBIL Back to PBIL home page