(data stored in ACNUC29543 zone)

EMBL: CP001044.PE304

CP001044.PE304       Location/Qualifiers
FT   CDS             346010..346180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3419"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72573"
FT                   /db_xref="GOA:B2JL44"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL44"
FT                   /protein_id="ACC72573.1"
FT                   /translation="MNDRPRIPRQPLAPSAKIFAAMFVALFIALFALLMTGAVAGIVRM
FT                   VRWIMSTQCGG"
     MNDRPRIPRQ PLAPSAKIFA AMFVALFIAL FALLMTGAVA GIVRMVRWIM STQCGG            56
//

If you have problems or comments...

PBIL Back to PBIL home page