(data stored in ACNUC29543 zone)

EMBL: CP001044.PE306

CP001044.PE306       Location/Qualifiers
FT   CDS             347223..347495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3421"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72575"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL46"
FT                   /protein_id="ACC72575.1"
FT                   /translation="MGEGAYPPAADTGDGRDASGEKKARQVKDFPEASGRFLRSGETAR
FT                   ETGHSRPRLDGRFGDAAADTATFDGHPAPRAVQSRFEFGDERSGL"
     MGEGAYPPAA DTGDGRDASG EKKARQVKDF PEASGRFLRS GETARETGHS RPRLDGRFGD        60
     AAADTATFDG HPAPRAVQSR FEFGDERSGL                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page