(data stored in ACNUC29543 zone)

EMBL: CP001044.PE307

CP001044.PE307       Location/Qualifiers
FT   CDS             347505..348611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3422"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72576"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL47"
FT                   /protein_id="ACC72576.1"
FT                   /translation="MTKNTVMSADDLFAAMKSDFEGKRRRKFAAGLLVALIDFMKALDT
FT                   PSLKLKGLDEFYAKFPRQIKTAAGLGANTLIVSKPAGGTVSIRPFYGAIENFFRNKEKR
FT                   YDFPSAAPHATQSWPDYVDWIGSLATFDLPTLDSLRDKVVKYVLEKLPSHEVDSSEIAK
FT                   DPPVFEIFLRDFNFRAVGRGEPTGSGFQGAVFAYIRADSPHLQVEVDKTRTGSKRVHRI
FT                   GDIDAWDGSRLVKTCEVKHFKVMTADAIDFTAFAGEAGKRRAGAYLVAEDFESEETRSA
FT                   IEELGVKTMTLEDLKHHVSVWDPLKQQIALQAFEYFITHREQNSSLTSRFRQFCLDKGF
FT                   RYVWSRPVVDDYGNQVSLLVLDESWKAD"
     MTKNTVMSAD DLFAAMKSDF EGKRRRKFAA GLLVALIDFM KALDTPSLKL KGLDEFYAKF        60
     PRQIKTAAGL GANTLIVSKP AGGTVSIRPF YGAIENFFRN KEKRYDFPSA APHATQSWPD       120
     YVDWIGSLAT FDLPTLDSLR DKVVKYVLEK LPSHEVDSSE IAKDPPVFEI FLRDFNFRAV       180
     GRGEPTGSGF QGAVFAYIRA DSPHLQVEVD KTRTGSKRVH RIGDIDAWDG SRLVKTCEVK       240
     HFKVMTADAI DFTAFAGEAG KRRAGAYLVA EDFESEETRS AIEELGVKTM TLEDLKHHVS       300
     VWDPLKQQIA LQAFEYFITH REQNSSLTSR FRQFCLDKGF RYVWSRPVVD DYGNQVSLLV       360
     LDESWKAD                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page