(data stored in ACNUC29543 zone)

EMBL: CP001044.PE308

CP001044.PE308       Location/Qualifiers
FT   CDS             348742..349866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3423"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   rca:Rcas_1171 DNA methylase N-4/N-6 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3423"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72577"
FT                   /db_xref="GOA:B2JL48"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL48"
FT                   /protein_id="ACC72577.1"
FT                   /translation="MSLAPGVIRDSIIEYLAMVGKDASTEEIVAAVKRSVGAAPTSSVR
FT                   SYLSLNTPTTFERVGRGRYRLRSASLLDHHATRETKILKLGQATLHQGDCFEWLASQKP
FT                   SSVHAVVTDPPYGLVEYTAKETAKLRAGKGGVWRIPPSFDGHQRAPLPRFTVLTDTDRQ
FT                   ALHAFFKRFGTLIGRVAVPGANVVIASNPLLAHIVAEAMGLAGLELRGYIARQVMTMRG
FT                   GDRPKNAHEEFDGVSVMPRSQWEPWVVLRKPLEGRVQDNLRRWGTGGFRRPSKERPFGD
FT                   LIKSHPTPASEKKIAPHPSLKPQAFMRQIVRAVLPLEEGIVLDPFMGAGSTLAAANAVG
FT                   YQSCGVELDEEFFALAAKAVPKLAAIPVRDLDAE"
     MSLAPGVIRD SIIEYLAMVG KDASTEEIVA AVKRSVGAAP TSSVRSYLSL NTPTTFERVG        60
     RGRYRLRSAS LLDHHATRET KILKLGQATL HQGDCFEWLA SQKPSSVHAV VTDPPYGLVE       120
     YTAKETAKLR AGKGGVWRIP PSFDGHQRAP LPRFTVLTDT DRQALHAFFK RFGTLIGRVA       180
     VPGANVVIAS NPLLAHIVAE AMGLAGLELR GYIARQVMTM RGGDRPKNAH EEFDGVSVMP       240
     RSQWEPWVVL RKPLEGRVQD NLRRWGTGGF RRPSKERPFG DLIKSHPTPA SEKKIAPHPS       300
     LKPQAFMRQI VRAVLPLEEG IVLDPFMGAG STLAAANAVG YQSCGVELDE EFFALAAKAV       360
     PKLAAIPVRD LDAE                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page