(data stored in ACNUC29543 zone)

EMBL: CP001044.PE309

CP001044.PE309       Location/Qualifiers
FT   CDS             complement(350060..351373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3424"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: bxe:Bxe_A3658
FT                   putative bacteriophage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3424"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72578"
FT                   /db_xref="GOA:B2JL49"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL49"
FT                   /protein_id="ACC72578.1"
FT                   /translation="MANERINRELIRRLEAERKAKIAAGGTLKVREIYDDLQRGFGVRM
FT                   SVKGSLSFVYRWTRPDGGQQRIVIGDASMTVEEARKALAKFIARTDHKVDDTSVRVTKH
FT                   ERRVADAKNVGMPTVGDYLDGDYRTFWLGSTRSETPEQNIKNIRRDFPDLMDRRLDEVT
FT                   RPAMKKWIEKRLADGCKATGINRVLGSIGGLFSYAVEHEIIAANPCAKLRCKIDPEEDS
FT                   EHGRELTAEEEQRLRVVLDERETRIREEAAARHDSRKVATIPGEFHSFVDHVKPAILLA
FT                   LNTGMRRSELLRARWTAIDWKAQTIRIEAWTSKVKRTRVIPMNVEALSILKAWRRQTRF
FT                   EFIFTNEIGECLREVRDWNKIKREAQIRDFRFMDTRHHTATRMINEGASPYHVQKLLGH
FT                   KDGRMTQRYMRARDVKLAEAVALLDVPRQADADHPVAA"
     MANERINREL IRRLEAERKA KIAAGGTLKV REIYDDLQRG FGVRMSVKGS LSFVYRWTRP        60
     DGGQQRIVIG DASMTVEEAR KALAKFIART DHKVDDTSVR VTKHERRVAD AKNVGMPTVG       120
     DYLDGDYRTF WLGSTRSETP EQNIKNIRRD FPDLMDRRLD EVTRPAMKKW IEKRLADGCK       180
     ATGINRVLGS IGGLFSYAVE HEIIAANPCA KLRCKIDPEE DSEHGRELTA EEEQRLRVVL       240
     DERETRIREE AAARHDSRKV ATIPGEFHSF VDHVKPAILL ALNTGMRRSE LLRARWTAID       300
     WKAQTIRIEA WTSKVKRTRV IPMNVEALSI LKAWRRQTRF EFIFTNEIGE CLREVRDWNK       360
     IKREAQIRDF RFMDTRHHTA TRMINEGASP YHVQKLLGHK DGRMTQRYMR ARDVKLAEAV       420
     ALLDVPRQAD ADHPVAA                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page