(data stored in ACNUC29543 zone)

EMBL: CP001044.PE312

CP001044.PE312       Location/Qualifiers
FT   CDS             352713..354659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3427"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; GAF domain protein;
FT                   SMART: AAA ATPase; KEGG: bxe:Bxe_B1075 sigma54 specific
FT                   transcriptional regulator with GAF sensor, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3427"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72581"
FT                   /db_xref="GOA:B2JL52"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL52"
FT                   /protein_id="ACC72581.1"
FT                   /translation="MTQRSVTPSVMGRADALAQAHARSREFGLRASEAPDFHPLQPFAL
FT                   RDLVELNRSLYAHALPVMETLHAQIVDTESMVLLTDSNGVILHSLGDSDFVEKASRVAL
FT                   CAGVSWSEAHRGTNAIGTALAEGEPTVVHGGEHFLEANRILTCSCAPIADPYGRTIGAL
FT                   DVSGDPRGFHKHTLALVRMSAQIIENQLFANQFGNAVRVRFHARSEFIGTLFEGLAAFG
FT                   ANGTLLAANRSALFQFGRPLDALLAQPFEALFGTAFPAALQQASRAPGECLTLMLPSGV
FT                   RVLARAEYAARPAFSADARPQHTAAPVPPAPASCKPRAAAITFATLDTGDARMAAVLGR
FT                   VEKVRGRDIPLLVLGKTGTGKEWLARAMHEESPRRDAPFVAVNCASLPDTLIEAELFGY
FT                   EDGAFTGARKRGNVGKIVQADGGTLFLDEIGDMPLAQQVRLMRVLQERSVVPLGGTRAV
FT                   PVDVRVVCATHRNLRAMIEAGTFREDLYYRINGLVVTLPALAERTDLPVLVERILGRLR
FT                   LVEPDSDRMPARVSLEVLDCFARCRWPGNLRQLANVLRTAGIMAEGAAEIGLDHLPDDF
FT                   LHDCEPPRDTPLHALPATDPPLAARPANMEELQATLIEQTLARNNGNISAAARELGLAR
FT                   NTVYRYMRMRTTH"
     MTQRSVTPSV MGRADALAQA HARSREFGLR ASEAPDFHPL QPFALRDLVE LNRSLYAHAL        60
     PVMETLHAQI VDTESMVLLT DSNGVILHSL GDSDFVEKAS RVALCAGVSW SEAHRGTNAI       120
     GTALAEGEPT VVHGGEHFLE ANRILTCSCA PIADPYGRTI GALDVSGDPR GFHKHTLALV       180
     RMSAQIIENQ LFANQFGNAV RVRFHARSEF IGTLFEGLAA FGANGTLLAA NRSALFQFGR       240
     PLDALLAQPF EALFGTAFPA ALQQASRAPG ECLTLMLPSG VRVLARAEYA ARPAFSADAR       300
     PQHTAAPVPP APASCKPRAA AITFATLDTG DARMAAVLGR VEKVRGRDIP LLVLGKTGTG       360
     KEWLARAMHE ESPRRDAPFV AVNCASLPDT LIEAELFGYE DGAFTGARKR GNVGKIVQAD       420
     GGTLFLDEIG DMPLAQQVRL MRVLQERSVV PLGGTRAVPV DVRVVCATHR NLRAMIEAGT       480
     FREDLYYRIN GLVVTLPALA ERTDLPVLVE RILGRLRLVE PDSDRMPARV SLEVLDCFAR       540
     CRWPGNLRQL ANVLRTAGIM AEGAAEIGLD HLPDDFLHDC EPPRDTPLHA LPATDPPLAA       600
     RPANMEELQA TLIEQTLARN NGNISAAARE LGLARNTVYR YMRMRTTH                    648
//

If you have problems or comments...

PBIL Back to PBIL home page