(data stored in ACNUC29543 zone)

EMBL: CP001044.PE32

CP001044.PE32        Location/Qualifiers
FT   CDS             complement(27908..28852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_3735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3133"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72301"
FT                   /db_xref="GOA:B2JRH4"
FT                   /db_xref="InterPro:IPR004352"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016062"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH4"
FT                   /protein_id="ACC72301.1"
FT                   /translation="MRRVLAAFAAFAAFALPLAGAHGADRAAAVETRAFEASPWMSYYG
FT                   DAAGLGSLARVASRFRVIDVDLDPGTDNFTPAEVAVLKNGGRNIVLSYLNLGSCETWRS
FT                   YWREAPAGFVSCAANTAAHAGMYCGYGQEVWMNLSNAAYRRLIVDYVAPRLVAQGADGF
FT                   YLDNLEIVEHGTATRNGPCDAACAQGGLDLVRELREKYPRLVFVMQNATGRTTREGSTG
FT                   GVAFAALLDGVAHEEVYAPKYDASAEAELAVWQAMTLTPNGHAFWIATLDYVGGCDAST
FT                   RARRVFARSRAKGFVPYASDSSARQGVVCYWGK"
     MRRVLAAFAA FAAFALPLAG AHGADRAAAV ETRAFEASPW MSYYGDAAGL GSLARVASRF        60
     RVIDVDLDPG TDNFTPAEVA VLKNGGRNIV LSYLNLGSCE TWRSYWREAP AGFVSCAANT       120
     AAHAGMYCGY GQEVWMNLSN AAYRRLIVDY VAPRLVAQGA DGFYLDNLEI VEHGTATRNG       180
     PCDAACAQGG LDLVRELREK YPRLVFVMQN ATGRTTREGS TGGVAFAALL DGVAHEEVYA       240
     PKYDASAEAE LAVWQAMTLT PNGHAFWIAT LDYVGGCDAS TRARRVFARS RAKGFVPYAS       300
     DSSARQGVVC YWGK                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page