(data stored in ACNUC29543 zone)

EMBL: CP001044.PE320

CP001044.PE320       Location/Qualifiers
FT   CDS             complement(360547..361314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3436"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72589"
FT                   /db_xref="GOA:B2JL60"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL60"
FT                   /protein_id="ACC72589.1"
FT                   /translation="MVGKLLMRGMLAGIVAGLLTFAFARVAGEPLVDTAISLEHKLHAE
FT                   HDHADAGGHDHDEELVSRGTQAGLGLLTGVVAYGMAFGGLFALSFAYLHGRVGKLSARA
FT                   LSAWLALGAYVAVVLVPTIKYPANPPSVGDPDTIGTRTGLFFLMIVTSLVVAVFSMKVR
FT                   KHLMPRLGVWNASITGGIVFIAIIAAIQIALPTVNEVPEAFPAVVLWKFRVTALGMQAI
FT                   TWAVIGLLFGALAERSERIARESNAAARKSAYL"
     MVGKLLMRGM LAGIVAGLLT FAFARVAGEP LVDTAISLEH KLHAEHDHAD AGGHDHDEEL        60
     VSRGTQAGLG LLTGVVAYGM AFGGLFALSF AYLHGRVGKL SARALSAWLA LGAYVAVVLV       120
     PTIKYPANPP SVGDPDTIGT RTGLFFLMIV TSLVVAVFSM KVRKHLMPRL GVWNASITGG       180
     IVFIAIIAAI QIALPTVNEV PEAFPAVVLW KFRVTALGMQ AITWAVIGLL FGALAERSER       240
     IARESNAAAR KSAYL                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page