(data stored in ACNUC29543 zone)

EMBL: CP001044.PE325

CP001044.PE325       Location/Qualifiers
FT   CDS             363705..363989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3441"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72594"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG1"
FT                   /protein_id="ACC72594.1"
FT                   /translation="MTQGVKTYKGYEIHPLVYPRRTAAGVTHRNSIDSGYDASVRICRV
FT                   GANPAADGRVFRFAYFRPFEGAGKARMACIEHASQVIDGRVDGQSVSDL"
     MTQGVKTYKG YEIHPLVYPR RTAAGVTHRN SIDSGYDASV RICRVGANPA ADGRVFRFAY        60
     FRPFEGAGKA RMACIEHASQ VIDGRVDGQS VSDL                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page