(data stored in ACNUC29543 zone)

EMBL: CP001044.PE326

CP001044.PE326       Location/Qualifiers
FT   CDS             364126..364389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3442"
FT                   /product="translation initiation factor IF-1"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   RNA binding S1 domain protein; S1 IF1 family protein; KEGG:
FT                   bxe:Bxe_B1067 translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3442"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72595"
FT                   /db_xref="GOA:B2JLG2"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG2"
FT                   /protein_id="ACC72595.1"
FT                   /translation="MAKEELIELDGIVDEVLPDSRYRVTLDNGVVVGAYASGRMRKNHI
FT                   RILAGDRVTLELSVYDLTKGRINFRHKDERSSGPRSAPVRRR"
     MAKEELIELD GIVDEVLPDS RYRVTLDNGV VVGAYASGRM RKNHIRILAG DRVTLELSVY        60
     DLTKGRINFR HKDERSSGPR SAPVRRR                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page