(data stored in ACNUC29543 zone)

EMBL: CP001044.PE329

CP001044.PE329       Location/Qualifiers
FT   CDS             366960..367535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3445"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver; ANTAR domain
FT                   protein; KEGG: bxe:Bxe_B1048 response regulator receiver
FT                   (CheY) and ANTAR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3445"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72598"
FT                   /db_xref="GOA:B2JLG5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG5"
FT                   /protein_id="ACC72598.1"
FT                   /translation="MLRVLLVTDTDKPIGELRDALARLGYDMLAATASPQALHETVESE
FT                   RPDVVIIDTESPSRDTLEQLAVMNATAPRPVLMFSNDANQQLIRDAVGAGVTAYLVEGL
FT                   ATERLAPILEVALARFAQESQLRERLAHAENELAERKLIDRAKRMLMDSQKMTEHAAYA
FT                   TMRKRAMNQGVKLAEVARQIVAAADLPD"
     MLRVLLVTDT DKPIGELRDA LARLGYDMLA ATASPQALHE TVESERPDVV IIDTESPSRD        60
     TLEQLAVMNA TAPRPVLMFS NDANQQLIRD AVGAGVTAYL VEGLATERLA PILEVALARF       120
     AQESQLRERL AHAENELAER KLIDRAKRML MDSQKMTEHA AYATMRKRAM NQGVKLAEVA       180
     RQIVAAADLP D                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page