(data stored in ACNUC29543 zone)

EMBL: CP001044.PE33

CP001044.PE33        Location/Qualifiers
FT   CDS             complement(28957..31275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3134"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: bxe:Bxe_A1494 putative diguanylate
FT                   cyclase/phosphodiesterase(GGDEF & EAL domains) with PAS/PAC
FT                   and GAF sensor(s); TIGRFAM: PAS sensor protein; diguanylate
FT                   cyclase; PFAM: GGDEF domain containing protein; EAL domain
FT                   protein; GAF domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3134"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72302"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH5"
FT                   /protein_id="ACC72302.1"
FT                   /translation="MSRQVTADIATDKPAGRTRHGADLAAEVRASEQSVLRLLTRSTPL
FT                   PELLAEVCRRAETLLGEGARCSILVLDTDGFTVRVGAAPSLPPQYSAAIDGMRLGPCAG
FT                   SCGTAMHDRRLVIVEDIERDPLWADYRHLALPLGLRACWSVPFEDDAGQVLGAFGVYYD
FT                   RRRRPNDGEQALLREIGQSVGLAVHQDLMRKRLAQSEEHHRLVVDHLNEGIVVQSREGV
FT                   VLACNPSARRMLRATGEVIGRDIYKVIRAAFWDDGSPVETAEQPTRRVLRTGRPVVGIT
FT                   LRLELVGGGSIWITENVVPIFKRGETEAGAVLVSFNDISAVQAARAQLQYLATRDSLTG
FT                   LYNRAYLADRMSERLAPHTSAAAHGRGEPRAAARRLAVLFVDLDGFKKVNDIAGHEAGD
FT                   ALLCSVAARLAGCVRSEDTLARVGGDEFVIATGDYTDASFLTSLAQRVLDTIARPFAVG
FT                   GNEYYLGASIGISLFPDDGCDAQTLMRNADSAMYDAKQRGRHNFQFFTAELSQRLKRRF
FT                   GIEQSLRRALAAGELSLAYQPIVEGATGRIVGAEALLRWRNDELGQVSPVEFIPVAEDT
FT                   GMIIDIGRWVLENACRQAVEWRRTITPHLMIAVNLSPRQINGELIGHVAATLEQTGLEP
FT                   SALELEITEGVLMSDSESVMPLLTTLAGMGVRISVDDFGTGYSSLSYLKRFPLHSLKVD
FT                   RSFVAGLPGHRDAVAITHAVVAMAHSLGMSVTAEGVETSEQSAFLRSIGCERQQGYLFG
FT                   RPVVPGDFAREAQRLHAGT"
     MSRQVTADIA TDKPAGRTRH GADLAAEVRA SEQSVLRLLT RSTPLPELLA EVCRRAETLL        60
     GEGARCSILV LDTDGFTVRV GAAPSLPPQY SAAIDGMRLG PCAGSCGTAM HDRRLVIVED       120
     IERDPLWADY RHLALPLGLR ACWSVPFEDD AGQVLGAFGV YYDRRRRPND GEQALLREIG       180
     QSVGLAVHQD LMRKRLAQSE EHHRLVVDHL NEGIVVQSRE GVVLACNPSA RRMLRATGEV       240
     IGRDIYKVIR AAFWDDGSPV ETAEQPTRRV LRTGRPVVGI TLRLELVGGG SIWITENVVP       300
     IFKRGETEAG AVLVSFNDIS AVQAARAQLQ YLATRDSLTG LYNRAYLADR MSERLAPHTS       360
     AAAHGRGEPR AAARRLAVLF VDLDGFKKVN DIAGHEAGDA LLCSVAARLA GCVRSEDTLA       420
     RVGGDEFVIA TGDYTDASFL TSLAQRVLDT IARPFAVGGN EYYLGASIGI SLFPDDGCDA       480
     QTLMRNADSA MYDAKQRGRH NFQFFTAELS QRLKRRFGIE QSLRRALAAG ELSLAYQPIV       540
     EGATGRIVGA EALLRWRNDE LGQVSPVEFI PVAEDTGMII DIGRWVLENA CRQAVEWRRT       600
     ITPHLMIAVN LSPRQINGEL IGHVAATLEQ TGLEPSALEL EITEGVLMSD SESVMPLLTT       660
     LAGMGVRISV DDFGTGYSSL SYLKRFPLHS LKVDRSFVAG LPGHRDAVAI THAVVAMAHS       720
     LGMSVTAEGV ETSEQSAFLR SIGCERQQGY LFGRPVVPGD FAREAQRLHA GT               772
//

If you have problems or comments...

PBIL Back to PBIL home page