(data stored in ACNUC29543 zone)

EMBL: CP001044.PE330

CP001044.PE330       Location/Qualifiers
FT   CDS             367546..368688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3446"
FT                   /product="ABC nitrate transporter, periplasmic ligand
FT                   binding protein"
FT                   /note="KEGG: bxe:Bxe_B1047 ABC nitrate transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3446"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72599"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG6"
FT                   /protein_id="ACC72599.1"
FT                   /translation="MNSTANTALSADSGKLEKSHLRLGFVALSDAAPLVAAKLLEFGHA
FT                   HGLTIELLKQPSWAAIRDKLLSGDLDAAHSLYGLVYGVQLGLGGPQTDMAVLMVLNRNG
FT                   QAITVSNRLAAALDEHKTLPAALATLGRKPVFAQTFPTGTHAMWLYYWLASQGVDPLRD
FT                   IDSVVIPPPQMVDALARDRLDGLCVGEPWNAVAQERGVGRTIAYTSEVWPDHPEKVLAS
FT                   RRDFVTRYPNTARALVQTMLEACRWLDDDEHRVEIARRLAADEFLGVPAASIASRLVSA
FT                   GCDETRRPVAFFADGAVNYPHPAEGVWFFAQYARWGMVHSRGDFARIANEVNQVQLYRQ
FT                   AAINVGVAVRDDAPSVQLIDGRRWDGNFDRAYLQGFSIKA"
     MNSTANTALS ADSGKLEKSH LRLGFVALSD AAPLVAAKLL EFGHAHGLTI ELLKQPSWAA        60
     IRDKLLSGDL DAAHSLYGLV YGVQLGLGGP QTDMAVLMVL NRNGQAITVS NRLAAALDEH       120
     KTLPAALATL GRKPVFAQTF PTGTHAMWLY YWLASQGVDP LRDIDSVVIP PPQMVDALAR       180
     DRLDGLCVGE PWNAVAQERG VGRTIAYTSE VWPDHPEKVL ASRRDFVTRY PNTARALVQT       240
     MLEACRWLDD DEHRVEIARR LAADEFLGVP AASIASRLVS AGCDETRRPV AFFADGAVNY       300
     PHPAEGVWFF AQYARWGMVH SRGDFARIAN EVNQVQLYRQ AAINVGVAVR DDAPSVQLID       360
     GRRWDGNFDR AYLQGFSIKA                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page