(data stored in ACNUC29543 zone)

EMBL: CP001044.PE331

CP001044.PE331       Location/Qualifiers
FT   CDS             complement(368803..369744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3447"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="TIGRFAM: choline ABC transporter, periplasmic
FT                   binding protein; PFAM: Substrate-binding region of ABC-type
FT                   glycine betaine transport system; KEGG: bam:Bamb_4564
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3447"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72600"
FT                   /db_xref="GOA:B2JLG7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG7"
FT                   /protein_id="ACC72600.1"
FT                   /translation="MKRKLMMAAALMMTAAATAQAADPAACRNVRFADVGWTDIAATTG
FT                   LASTIFQGLGYSPTKTIASVPITFAGIKSKQIDVFLGYWAPTMDPIIQPFVKAGTIKVL
FT                   ATPNLTGAKYTLAVPDYVYNGGLKNFSDIAKYADKLDGKIYGIEPGNDGNALIKKMIDG
FT                   NQFGLGKFKLVESSEAGMLVEVNRAVRDKKWIVFLGWEPHPMNVQMKIDYLAGGDDVFG
FT                   PNYGEAKVFTATPPDYAARCPNAAKLVSNLQFTTAIENHVMVPIMNKEDANKAALAWLK
FT                   ANPQALDKWLAGVQTFDGKDGLPAVKAYIAAH"
     MKRKLMMAAA LMMTAAATAQ AADPAACRNV RFADVGWTDI AATTGLASTI FQGLGYSPTK        60
     TIASVPITFA GIKSKQIDVF LGYWAPTMDP IIQPFVKAGT IKVLATPNLT GAKYTLAVPD       120
     YVYNGGLKNF SDIAKYADKL DGKIYGIEPG NDGNALIKKM IDGNQFGLGK FKLVESSEAG       180
     MLVEVNRAVR DKKWIVFLGW EPHPMNVQMK IDYLAGGDDV FGPNYGEAKV FTATPPDYAA       240
     RCPNAAKLVS NLQFTTAIEN HVMVPIMNKE DANKAALAWL KANPQALDKW LAGVQTFDGK       300
     DGLPAVKAYI AAH                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page