(data stored in ACNUC29543 zone)

EMBL: CP001044.PE339

CP001044.PE339       Location/Qualifiers
FT   CDS             complement(379313..380515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3455"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72608"
FT                   /db_xref="GOA:B2JLH5"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLH5"
FT                   /protein_id="ACC72608.1"
FT                   /translation="MEPTSLPQFNDVPWRWIAYGASTIVAGAVAFGFVHEVELKQDVQC
FT                   EIVSPSDVKVQGTSGLVSSVYVHPGERVHQGTPLFSVQRDLSLASDGRQRPQFDEQMRD
FT                   EQIRMVDLQYDQRRAQLAAQLDASNATAAARQAEARALDEQIEQNRQLVSEAQQKLGRL
FT                   QSVSDYVTADRIEQASADTHQMKISVAQGLARRQQLAGEIVALHSTQGNLAAQLKENDA
FT                   RHVREIQDIRMRFEQARQDSTISAPKSGVVAFSNLVPGRTLDAADVALVIVTDDRSALR
FT                   AALRMPSRRRGFVHTGQTVRLKFDAFPYVKFGTYDARVDAISPTTIQSGMSVAPASPAA
FT                   PKETGDGDFMAWATLRGRTFDYGKQRFDILPGMRATASIVVERRTIAEWVLEPLFRTLR
FT                   G"
     MEPTSLPQFN DVPWRWIAYG ASTIVAGAVA FGFVHEVELK QDVQCEIVSP SDVKVQGTSG        60
     LVSSVYVHPG ERVHQGTPLF SVQRDLSLAS DGRQRPQFDE QMRDEQIRMV DLQYDQRRAQ       120
     LAAQLDASNA TAAARQAEAR ALDEQIEQNR QLVSEAQQKL GRLQSVSDYV TADRIEQASA       180
     DTHQMKISVA QGLARRQQLA GEIVALHSTQ GNLAAQLKEN DARHVREIQD IRMRFEQARQ       240
     DSTISAPKSG VVAFSNLVPG RTLDAADVAL VIVTDDRSAL RAALRMPSRR RGFVHTGQTV       300
     RLKFDAFPYV KFGTYDARVD AISPTTIQSG MSVAPASPAA PKETGDGDFM AWATLRGRTF       360
     DYGKQRFDIL PGMRATASIV VERRTIAEWV LEPLFRTLRG                             400
//

If you have problems or comments...

PBIL Back to PBIL home page