(data stored in ACNUC29543 zone)

EMBL: CP001044.PE34

CP001044.PE34        Location/Qualifiers
FT   CDS             complement(31367..32200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3135"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72303"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH6"
FT                   /protein_id="ACC72303.1"
FT                   /translation="MCRWLAYTGNPIQLEAVLFRAKHSLIDQSLHSRLGQTTTNGDGFG
FT                   VGWYGHPTDIPFRYRCAHPAWSDRNLRDAARAVRAPLFVAHIRAATDTPSQETNCHPFR
FT                   YGRWLFMHNGLIRDYPKVRRDLMLGIDPDLFASIEGSTDSEVMFYLALTFGLEFDPVLA
FT                   LERMAGFIEETGRRHGIEAPLNMTVCATDGEQIVSARYSSERQSRSLYHSTSIRHLMEL
FT                   YPDDPRLAAVGEDAFLVLSEPLVDLEGWWEEIPESTAIVARGGAIESQTFDPHRT"
     MCRWLAYTGN PIQLEAVLFR AKHSLIDQSL HSRLGQTTTN GDGFGVGWYG HPTDIPFRYR        60
     CAHPAWSDRN LRDAARAVRA PLFVAHIRAA TDTPSQETNC HPFRYGRWLF MHNGLIRDYP       120
     KVRRDLMLGI DPDLFASIEG STDSEVMFYL ALTFGLEFDP VLALERMAGF IEETGRRHGI       180
     EAPLNMTVCA TDGEQIVSAR YSSERQSRSL YHSTSIRHLM ELYPDDPRLA AVGEDAFLVL       240
     SEPLVDLEGW WEEIPESTAI VARGGAIESQ TFDPHRT                                277
//

If you have problems or comments...

PBIL Back to PBIL home page