(data stored in ACNUC29543 zone)

EMBL: CP001044.PE341

CP001044.PE341       Location/Qualifiers
FT   CDS             381816..382061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3457"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72610"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLH7"
FT                   /protein_id="ACC72610.1"
FT                   /translation="MEVNESAYYRSTRRRKRSIGFDHCRVIACSRRHPTFNLASTSAQC
FT                   LTGGEIVPPPDCPPDELLPPEITNVIVVVLELELAL"
     MEVNESAYYR STRRRKRSIG FDHCRVIACS RRHPTFNLAS TSAQCLTGGE IVPPPDCPPD        60
     ELLPPEITNV IVVVLELELA L                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page