(data stored in ACNUC29543 zone)

EMBL: CP001044.PE342

CP001044.PE342       Location/Qualifiers
FT   CDS             complement(382205..382927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3458"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72611"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLH8"
FT                   /protein_id="ACC72611.1"
FT                   /translation="MAVRSKVSLCFAVMCLLCDLVDAFGGATFNSSSANAMDFDGAQTS
FT                   RLPAVNAGRTTRHAHSVVSRSRTRRTRCEVARSACRPLASHCRHKSMASVGHVRPRCSV
FT                   IHRRRRERLYAHRNPPAPGQLVTRASEATLVPRCTNGCDLAAGEVLSRDVMRPVESERV
FT                   AQAPRAPDFGGWFGSERPLTVSVRESASTVEQTIAVNVATADQTDGAAKLMLLSAALPA
FT                   TPPLSEWNASSPVAATSR"
     MAVRSKVSLC FAVMCLLCDL VDAFGGATFN SSSANAMDFD GAQTSRLPAV NAGRTTRHAH        60
     SVVSRSRTRR TRCEVARSAC RPLASHCRHK SMASVGHVRP RCSVIHRRRR ERLYAHRNPP       120
     APGQLVTRAS EATLVPRCTN GCDLAAGEVL SRDVMRPVES ERVAQAPRAP DFGGWFGSER       180
     PLTVSVRESA STVEQTIAVN VATADQTDGA AKLMLLSAAL PATPPLSEWN ASSPVAATSR       240
//

If you have problems or comments...

PBIL Back to PBIL home page