(data stored in ACNUC29543 zone)

EMBL: CP001044.PE35

CP001044.PE35        Location/Qualifiers
FT   CDS             complement(32261..32932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3136"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: bte:BTH_II1391 putative multiple antibiotic
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3136"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72304"
FT                   /db_xref="GOA:B2JRH7"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH7"
FT                   /protein_id="ACC72304.1"
FT                   /translation="MIASLVSEILFGFTGLISIINPIAIAFVFLDRTDSLTDAERAALA
FT                   RRVAINAFFVLLVVFFVGTPILHFFGISMEALRIGGGLAVAVSAWNMLNAPERQPNEAA
FT                   VKPVDPDNAMSKAFFPLTVPLTTGPGTMATAIALNANRSHKLSEFLMSSIASVTISVLV
FT                   MFAIWFTYNHAATFARLLGKEGTKVALRVSAFLLLCIGVQIILTGLAEFLAPIAAGRLN
FT                   N"
     MIASLVSEIL FGFTGLISII NPIAIAFVFL DRTDSLTDAE RAALARRVAI NAFFVLLVVF        60
     FVGTPILHFF GISMEALRIG GGLAVAVSAW NMLNAPERQP NEAAVKPVDP DNAMSKAFFP       120
     LTVPLTTGPG TMATAIALNA NRSHKLSEFL MSSIASVTIS VLVMFAIWFT YNHAATFARL       180
     LGKEGTKVAL RVSAFLLLCI GVQIILTGLA EFLAPIAAGR LNN                         223
//

If you have problems or comments...

PBIL Back to PBIL home page