(data stored in ACNUC29543 zone)

EMBL: CP001044.PE357

CP001044.PE357       Location/Qualifiers
FT   CDS             397774..398682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3473"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72626"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLJ3"
FT                   /protein_id="ACC72626.1"
FT                   /translation="MSDTLITEAEAAHDHAMRHWTFDGHARMRIGSEEHKQMFCRMLLE
FT                   THNPYKPAVIDWPQLPPDALKRITSLPIWDIAVQTEGRASIRVATYAGQVQDPLVREAI
FT                   EMDAAEEARHKHVLSRLVAAYGIELAPEPDYPAPRDPEWAWMFTGYSECIDSFFAFGLF
FT                   RSAQLSGYFPEELVDTFEPVIQEEARHILFFVNWVAWYRRTMPWWRRPWHSLRVGAIWV
FT                   KLIWDRVAIAKGIDSNGVAHDSNFLPANSATIGQALSTRQLIELCLQENDQRMAGYDKR
FT                   LVRPMLVPKLARLALRLMRAQ"
     MSDTLITEAE AAHDHAMRHW TFDGHARMRI GSEEHKQMFC RMLLETHNPY KPAVIDWPQL        60
     PPDALKRITS LPIWDIAVQT EGRASIRVAT YAGQVQDPLV REAIEMDAAE EARHKHVLSR       120
     LVAAYGIELA PEPDYPAPRD PEWAWMFTGY SECIDSFFAF GLFRSAQLSG YFPEELVDTF       180
     EPVIQEEARH ILFFVNWVAW YRRTMPWWRR PWHSLRVGAI WVKLIWDRVA IAKGIDSNGV       240
     AHDSNFLPAN SATIGQALST RQLIELCLQE NDQRMAGYDK RLVRPMLVPK LARLALRLMR       300
     AQ                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page