(data stored in ACNUC29543 zone)

EMBL: CP001044.PE36

CP001044.PE36        Location/Qualifiers
FT   CDS             33246..33458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1296 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3137"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72305"
FT                   /db_xref="GOA:B2JRH8"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH8"
FT                   /protein_id="ACC72305.1"
FT                   /translation="MSFRLLAVLPFIGILLGVPFVNRVEPLVLGMPFVLAWIVMWVVLS
FT                   SIIMGLIYRFDPTNRHAGPGEEVRS"
     MSFRLLAVLP FIGILLGVPF VNRVEPLVLG MPFVLAWIVM WVVLSSIIMG LIYRFDPTNR        60
     HAGPGEEVRS                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page