(data stored in ACNUC29543 zone)

EMBL: CP001044.PE363

CP001044.PE363       Location/Qualifiers
FT   CDS             complement(407284..407688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3483"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72632"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLJ9"
FT                   /protein_id="ACC72632.1"
FT                   /translation="MSEHAAHVVNSISDLQMTEDGLYLLIHGNQPMTAIHRSVLDQLLV
FT                   ALPNAIEHSDRITSGNAQTAFAYQSYGWEIGRLNGTQTAVIRFRLAGNMGISFSLPCEQ
FT                   IAPLIEALNGVAASAGATVAQVTSDTVTLQ"
     MSEHAAHVVN SISDLQMTED GLYLLIHGNQ PMTAIHRSVL DQLLVALPNA IEHSDRITSG        60
     NAQTAFAYQS YGWEIGRLNG TQTAVIRFRL AGNMGISFSL PCEQIAPLIE ALNGVAASAG       120
     ATVAQVTSDT VTLQ                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page