(data stored in ACNUC29543 zone)

EMBL: CP001044.PE364

CP001044.PE364       Location/Qualifiers
FT   CDS             complement(407681..407884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3484"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72633"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLK0"
FT                   /protein_id="ACC72633.1"
FT                   /translation="MLEHIDPVVLVAVLRTSSSPLFSAWIARASSYEPWIEDTCAHHLD
FT                   DADRRPGTAVGSGARVDEVRHV"
     MLEHIDPVVL VAVLRTSSSP LFSAWIARAS SYEPWIEDTC AHHLDDADRR PGTAVGSGAR        60
     VDEVRHV                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page