(data stored in ACNUC29543 zone)

EMBL: CP001044.PE369

CP001044.PE369       Location/Qualifiers
FT   CDS             complement(418465..419610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3489"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rso:RS03141 putative resistance transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3489"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72638"
FT                   /db_xref="GOA:B2JLK5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLK5"
FT                   /protein_id="ACC72638.1"
FT                   /translation="MKFTRPSRRLLVVACIAAVGVIVWQAYAAFHKPQHPAAQETPVTI
FT                   GTVQRADVPLQLDALGTVTPRATVTVKTQVNGTLEAVLVKEGQRVNAGQPIARIDSRAL
FT                   RAQLLEAQGTLEHDEALLANAKADLARYETLIDGGSISRQTLDTQRATLRQYQGTVKAD
FT                   EGSVANLRVQVSYCDIVAPMDGTIGLLSTDAGNYVTTSDTTGIATITSDSPTTVVYALP
FT                   EDKMGEVVDAFHDKGALPVEIFARDKRTVLDHATLAAIDNQADTTTGTVKLKASAPNRD
FT                   GRLFPNRFVNVRMTVGTLRDALTVPTVAIQHGASGDFVLTMAAADVKRNAGTVALRHVT
FT                   AGVSYNDATVIEQGDVKAGDAIVLDGADKLDDGSAVKIVRN"
     MKFTRPSRRL LVVACIAAVG VIVWQAYAAF HKPQHPAAQE TPVTIGTVQR ADVPLQLDAL        60
     GTVTPRATVT VKTQVNGTLE AVLVKEGQRV NAGQPIARID SRALRAQLLE AQGTLEHDEA       120
     LLANAKADLA RYETLIDGGS ISRQTLDTQR ATLRQYQGTV KADEGSVANL RVQVSYCDIV       180
     APMDGTIGLL STDAGNYVTT SDTTGIATIT SDSPTTVVYA LPEDKMGEVV DAFHDKGALP       240
     VEIFARDKRT VLDHATLAAI DNQADTTTGT VKLKASAPNR DGRLFPNRFV NVRMTVGTLR       300
     DALTVPTVAI QHGASGDFVL TMAAADVKRN AGTVALRHVT AGVSYNDATV IEQGDVKAGD       360
     AIVLDGADKL DDGSAVKIVR N                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page