(data stored in ACNUC29543 zone)

EMBL: CP001044.PE372

CP001044.PE372       Location/Qualifiers
FT   CDS             complement(424496..425713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3492"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bxe:Bxe_A0708 membrane fusion protein, RND efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3492"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72641"
FT                   /db_xref="GOA:B2JLK8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLK8"
FT                   /protein_id="ACC72641.1"
FT                   /translation="MPALLKNRNFRMLAATAAISAVLPLLAACGDQHAAPPQQTPEVGV
FT                   VTIRPSAVPVTVELPGRVSAHLVAEVRARVDGIVQKRLYTEGSEVKAGQTLYKIDPAPY
FT                   IASLNSAKATLAKAQATLVSAHAEAARYKVLVAANAISKQDYDNAVASEGQATADVAAG
FT                   KAAVDTAQINLGYTDVSSPISGRIGKSSVTEGAYVQSSAATLLATVQQLDPVYVDLTQS
FT                   SLVGLKLRRDAQEGRLKTSGPNAAKVTLILEDGRPYGGTGKLEFSDVTVDQTTGSVTVR
FT                   ALFDNAQGVLLPGMYVRAKIEEGVNEQAFVVPQQGVTHDQKGDPTALVVGADGKVAMRQ
FT                   LVTSGTYGANWVVESGLQTGDRVIVQGVDKVRPGMSVKTVAAQLPAADTATQTAATPAS
FT                   GAQSAQ"
     MPALLKNRNF RMLAATAAIS AVLPLLAACG DQHAAPPQQT PEVGVVTIRP SAVPVTVELP        60
     GRVSAHLVAE VRARVDGIVQ KRLYTEGSEV KAGQTLYKID PAPYIASLNS AKATLAKAQA       120
     TLVSAHAEAA RYKVLVAANA ISKQDYDNAV ASEGQATADV AAGKAAVDTA QINLGYTDVS       180
     SPISGRIGKS SVTEGAYVQS SAATLLATVQ QLDPVYVDLT QSSLVGLKLR RDAQEGRLKT       240
     SGPNAAKVTL ILEDGRPYGG TGKLEFSDVT VDQTTGSVTV RALFDNAQGV LLPGMYVRAK       300
     IEEGVNEQAF VVPQQGVTHD QKGDPTALVV GADGKVAMRQ LVTSGTYGAN WVVESGLQTG       360
     DRVIVQGVDK VRPGMSVKTV AAQLPAADTA TQTAATPASG AQSAQ                       405
//

If you have problems or comments...

PBIL Back to PBIL home page