(data stored in ACNUC29543 zone)

EMBL: CP001044.PE374

CP001044.PE374       Location/Qualifiers
FT   CDS             426795..427565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3494"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bvi:Bcep1808_4761 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3494"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72643"
FT                   /db_xref="GOA:B2JLL0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLL0"
FT                   /protein_id="ACC72643.1"
FT                   /translation="MPDTPLQVLLVDDDADLRDLLRNFFQQRGIDFSVLHDATHLARRL
FT                   ERERPSIIVLDLMMPGVDGLTALKQLRASGNTIPVIMLTARADGVDRVIGLELGADDYL
FT                   GKPFMPQELLARIHAVLRRHALHPDAPPAEHREALEFGRFRLDFASRTLFRDNEPIRLT
FT                   GSEYALLEVFAQHPMETLSRTRIVDLLHGPDSEVTERGIDVPVWRLRRLLEDDPAAPRR
FT                   IQTMRGIGYMFVPGETGNGGNGGETSDDGSDATQ"
     MPDTPLQVLL VDDDADLRDL LRNFFQQRGI DFSVLHDATH LARRLERERP SIIVLDLMMP        60
     GVDGLTALKQ LRASGNTIPV IMLTARADGV DRVIGLELGA DDYLGKPFMP QELLARIHAV       120
     LRRHALHPDA PPAEHREALE FGRFRLDFAS RTLFRDNEPI RLTGSEYALL EVFAQHPMET       180
     LSRTRIVDLL HGPDSEVTER GIDVPVWRLR RLLEDDPAAP RRIQTMRGIG YMFVPGETGN       240
     GGNGGETSDD GSDATQ                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page