(data stored in ACNUC29543 zone)

EMBL: CP001044.PE379

CP001044.PE379       Location/Qualifiers
FT   CDS             431728..432702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3499"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: rru:Rru_A2447 mammalian cell entry related"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3499"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72648"
FT                   /db_xref="GOA:B2JLL5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLL5"
FT                   /protein_id="ACC72648.1"
FT                   /translation="MNPRPAVVGGFILGAITLGIAAIVFFGGAQLFAKTSNAVVFFGES
FT                   VAGLDVGSPVTFHGVRIGSVKRIAVHFSSETMTAKIPVYLEFESTNQAVWEGRKFGGRA
FT                   VDFERAVKAGLRAQLALQSFVTGQLRVDLDFRPGTPAQLTGSVTDAPEIPAIPSDLDQL
FT                   RNQLAGLPLRELSGSVQQALSSLTRLSDHVDVLLEPLAQSVIRTADAATQTLHATDATV
FT                   RHVEADATHTLHDLDLLLVDAREQLDARSGELSRTLVTTDRAVRQADTLLESLNDLADP
FT                   HAQFRGDLEATARDLAVSASRLRSFAETVERHPNALVIGRATR"
     MNPRPAVVGG FILGAITLGI AAIVFFGGAQ LFAKTSNAVV FFGESVAGLD VGSPVTFHGV        60
     RIGSVKRIAV HFSSETMTAK IPVYLEFEST NQAVWEGRKF GGRAVDFERA VKAGLRAQLA       120
     LQSFVTGQLR VDLDFRPGTP AQLTGSVTDA PEIPAIPSDL DQLRNQLAGL PLRELSGSVQ       180
     QALSSLTRLS DHVDVLLEPL AQSVIRTADA ATQTLHATDA TVRHVEADAT HTLHDLDLLL       240
     VDAREQLDAR SGELSRTLVT TDRAVRQADT LLESLNDLAD PHAQFRGDLE ATARDLAVSA       300
     SRLRSFAETV ERHPNALVIG RATR                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page