(data stored in ACNUC29543 zone)

EMBL: CP001044.PE381

CP001044.PE381       Location/Qualifiers
FT   CDS             433568..434425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3501"
FT                   /product="Amino acid transporter-like protein"
FT                   /note="KEGG: bxe:Bxe_C0744 arginine/ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3501"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72650"
FT                   /db_xref="GOA:B2JLL7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLL7"
FT                   /protein_id="ACC72650.1"
FT                   /translation="MARPATTTAPATNLAPEAKPALPSRKADKRKLGLLLLSGIVVGSM
FT                   IGGGAFNLPQNMAAGAGLGAIALAWGITLVGMFFLSNCFRTLADQRPELKSGIYSYARE
FT                   GFGRFAGFEMAWGYWLSSAFGNVAFAVLIMQTLGFFFPVLDGKNWQSIAGGSLLIWTTH
FT                   FMVLSGVKRTAMVNTIASVVNIITLSFGIAIVALVFQKHASLRTGILGTSYASWLLYAA
FT                   DPKFLLMSTILFVIGIPVFWYARREKDAGAPTFTPLERTAAGSLCVVAVTAVVLFATKT
FT                   VAIG"
     MARPATTTAP ATNLAPEAKP ALPSRKADKR KLGLLLLSGI VVGSMIGGGA FNLPQNMAAG        60
     AGLGAIALAW GITLVGMFFL SNCFRTLADQ RPELKSGIYS YAREGFGRFA GFEMAWGYWL       120
     SSAFGNVAFA VLIMQTLGFF FPVLDGKNWQ SIAGGSLLIW TTHFMVLSGV KRTAMVNTIA       180
     SVVNIITLSF GIAIVALVFQ KHASLRTGIL GTSYASWLLY AADPKFLLMS TILFVIGIPV       240
     FWYARREKDA GAPTFTPLER TAAGSLCVVA VTAVVLFATK TVAIG                       285
//

If you have problems or comments...

PBIL Back to PBIL home page