(data stored in ACNUC29543 zone)

EMBL: CP001044.PE385

CP001044.PE385       Location/Qualifiers
FT   CDS             complement(438726..441815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3505"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   rpc:RPC_1357 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3505"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72654"
FT                   /db_xref="GOA:B2JLM1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLM1"
FT                   /protein_id="ACC72654.1"
FT                   /translation="MKSFNLTEWALSHRAIVLFLILVIGIGGTFSFTRLGQLEDPNFSV
FT                   PSMTALVIWPGATAQQVQDELLNRMEKKFEQLDHFEKVVTYARQGYGGMTITVKGGTSH
FT                   ADQREAWYQARKKFGDIKLELPDGVVGPIFNDEYGDVTGLLYAVKGDGISQWELTDVAE
FT                   DIKRQLLKVPMVKKVDIYGKQAKKIYVEFSNERLAALGITPLQIAESLRSQNSVLASGQ
FT                   IDTHDDRVLVRVSGQFSSLDDIRNVPIAAGGRLLKLGDFTSITRGYEDPPIYTVRHNGQ
FT                   QVLMLGITMTDDGNIVDLGKAIDRTIAKVQLELPYGVELERVADQPTVVSESIWEFERS
FT                   LLEALTIVLAVCLISLGWRTGIVVGISVPIVLGVVALVMLTMGWNLERVSLGSLIIALG
FT                   LLVDDGIIAVEMMVVKMEEGWDRVKAAAYSYTATAMPRLTGALITAAAFMPIGFAKSTT
FT                   GEYAGGIFWIVGTAVLFSWVVSGLITPYLAVKMLPEDFGKQHRGGDPYDTAFYRKLRGW
FT                   IDLALERRWWVIAATVAALAAAIAASRFVPQQFFPNSARPELVVELRLKEGASFAATTE
FT                   QVKKMEAVLKKDKDVRFFTAYTGAGQPRFYLALNPELPNPGYAVFVVMTKDTQARERVR
FT                   SRLMGSVNAEFPQAWIRVTRLELGPPVGFPVQFRVVGSGTQKVREIAREVEAVVASSPK
FT                   VRDVQLDWNDPVRTLRVDLDQDKARALGLAPADVAFVTQTFMNGVTLSHLREREDLIDI
FT                   VARAVPSERLDLGMLKDINLYTREGTVVPLSQIARVRYELEEPVLWRRNRDMAITVRAD
FT                   VKDGEQGVSVTQEIRPLLKDIEAKLPFGYRIDVGGAVEESDKANRALMAVFPVMLITIL
FT                   TILMLQLQSFSRMTLVFLTAPLGLIGVVAGLFVFQAPLGFVAILGVTALSGMIMRNSVI
FT                   LVDQVQAEIAQGRDTWTAVVDAAVHRTRPVALTAAATVLAMIPLTRSIFWAPMAIAIMG
FT                   GLTVATLLTIFFMPALYAAWFKVRRNAELKPGDLPRVDAP"
     MKSFNLTEWA LSHRAIVLFL ILVIGIGGTF SFTRLGQLED PNFSVPSMTA LVIWPGATAQ        60
     QVQDELLNRM EKKFEQLDHF EKVVTYARQG YGGMTITVKG GTSHADQREA WYQARKKFGD       120
     IKLELPDGVV GPIFNDEYGD VTGLLYAVKG DGISQWELTD VAEDIKRQLL KVPMVKKVDI       180
     YGKQAKKIYV EFSNERLAAL GITPLQIAES LRSQNSVLAS GQIDTHDDRV LVRVSGQFSS       240
     LDDIRNVPIA AGGRLLKLGD FTSITRGYED PPIYTVRHNG QQVLMLGITM TDDGNIVDLG       300
     KAIDRTIAKV QLELPYGVEL ERVADQPTVV SESIWEFERS LLEALTIVLA VCLISLGWRT       360
     GIVVGISVPI VLGVVALVML TMGWNLERVS LGSLIIALGL LVDDGIIAVE MMVVKMEEGW       420
     DRVKAAAYSY TATAMPRLTG ALITAAAFMP IGFAKSTTGE YAGGIFWIVG TAVLFSWVVS       480
     GLITPYLAVK MLPEDFGKQH RGGDPYDTAF YRKLRGWIDL ALERRWWVIA ATVAALAAAI       540
     AASRFVPQQF FPNSARPELV VELRLKEGAS FAATTEQVKK MEAVLKKDKD VRFFTAYTGA       600
     GQPRFYLALN PELPNPGYAV FVVMTKDTQA RERVRSRLMG SVNAEFPQAW IRVTRLELGP       660
     PVGFPVQFRV VGSGTQKVRE IAREVEAVVA SSPKVRDVQL DWNDPVRTLR VDLDQDKARA       720
     LGLAPADVAF VTQTFMNGVT LSHLREREDL IDIVARAVPS ERLDLGMLKD INLYTREGTV       780
     VPLSQIARVR YELEEPVLWR RNRDMAITVR ADVKDGEQGV SVTQEIRPLL KDIEAKLPFG       840
     YRIDVGGAVE ESDKANRALM AVFPVMLITI LTILMLQLQS FSRMTLVFLT APLGLIGVVA       900
     GLFVFQAPLG FVAILGVTAL SGMIMRNSVI LVDQVQAEIA QGRDTWTAVV DAAVHRTRPV       960
     ALTAAATVLA MIPLTRSIFW APMAIAIMGG LTVATLLTIF FMPALYAAWF KVRRNAELKP      1020
     GDLPRVDAP                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page