(data stored in ACNUC29543 zone)

EMBL: CP001044.PE386

CP001044.PE386       Location/Qualifiers
FT   CDS             complement(441812..442906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3506"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   tbd:Tbd_2532 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3506"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72655"
FT                   /db_xref="GOA:B2JLM2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLM2"
FT                   /protein_id="ACC72655.1"
FT                   /translation="MKNLLRALFAAVPSAAMLVACGSKPAPDALRAVRTAEIRYDETLV
FT                   TDRYVGTVQPRHEVIEAFRVGGKVVKRKVDVGQKVREGDVLAVLDDTDYRLAEEAARQQ
FT                   LAAAISQARLAESDRRRLNSLKTDGSVSVSDDEKAQTGAQTTSSAAEAEGKKLELARNR
FT                   LKYTVLRASQSGVITSVRFEAGEVVAEGQPMVSIANAGEPEIVADLPEDRLSTFKTARY
FT                   KAWLASAPEQSFDVVLRELSPQATAQTRTYRARLKPAMPRALPLGATATLVVERPVGDA
FT                   SAAVIPASAITQNKGQPAVWVVHRVGSEPVGTVELIGVSVHGYRNDDVLVSGPPAGELI
FT                   VTAGVQKMAPGLKVALAETRQSVR"
     MKNLLRALFA AVPSAAMLVA CGSKPAPDAL RAVRTAEIRY DETLVTDRYV GTVQPRHEVI        60
     EAFRVGGKVV KRKVDVGQKV REGDVLAVLD DTDYRLAEEA ARQQLAAAIS QARLAESDRR       120
     RLNSLKTDGS VSVSDDEKAQ TGAQTTSSAA EAEGKKLELA RNRLKYTVLR ASQSGVITSV       180
     RFEAGEVVAE GQPMVSIANA GEPEIVADLP EDRLSTFKTA RYKAWLASAP EQSFDVVLRE       240
     LSPQATAQTR TYRARLKPAM PRALPLGATA TLVVERPVGD ASAAVIPASA ITQNKGQPAV       300
     WVVHRVGSEP VGTVELIGVS VHGYRNDDVL VSGPPAGELI VTAGVQKMAP GLKVALAETR       360
     QSVR                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page