(data stored in ACNUC29543 zone)

EMBL: CP001044.PE390

CP001044.PE390       Location/Qualifiers
FT   CDS             complement(446520..447569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3510"
FT                   /product="4-hydroxy-2-oxovalerate aldolase"
FT                   /note="TIGRFAM: 4-hydroxy-2-oxovalerate aldolase; PFAM:
FT                   pyruvate carboxyltransferase; DmpG communication domain
FT                   protein; KEGG: ppf:Pput_2873 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3510"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72659"
FT                   /db_xref="GOA:B2JLM6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JLM6"
FT                   /protein_id="ACC72659.1"
FT                   /translation="MDKKLYISDVTLRDGSHAIRHQYSVAQARRIAIALDDARVDSIEV
FT                   AHGDGLQGGSFNYGFGAHTDIEWIKAVASVVKHAKIATLLLPGIGTVRDLRAAYDAGAR
FT                   IARVATHCTEADISRQHIEYAREIGMEAVGFLMMSHMQTPRALAEQAKLMESYGATCCY
FT                   VVDSGGAMNMNDIRDRMRAFKDTLRPETQTGIHAHHNLSLGIANSIVAVEEGCDRVDAS
FT                   LAGMGAGAGNAPLEVFIAAAARLGWNHGTDLYRLMDAADDIVRPLQDRPVRVDRETLAL
FT                   GYAGVYSSFLRHAERAASKYGLKTVDILVELGRRRMVGGQEDMIVDVALDLCGAREFAS
FT                   SASGRADLI"
     MDKKLYISDV TLRDGSHAIR HQYSVAQARR IAIALDDARV DSIEVAHGDG LQGGSFNYGF        60
     GAHTDIEWIK AVASVVKHAK IATLLLPGIG TVRDLRAAYD AGARIARVAT HCTEADISRQ       120
     HIEYAREIGM EAVGFLMMSH MQTPRALAEQ AKLMESYGAT CCYVVDSGGA MNMNDIRDRM       180
     RAFKDTLRPE TQTGIHAHHN LSLGIANSIV AVEEGCDRVD ASLAGMGAGA GNAPLEVFIA       240
     AAARLGWNHG TDLYRLMDAA DDIVRPLQDR PVRVDRETLA LGYAGVYSSF LRHAERAASK       300
     YGLKTVDILV ELGRRRMVGG QEDMIVDVAL DLCGAREFAS SASGRADLI                   349
//

If you have problems or comments...

PBIL Back to PBIL home page