(data stored in ACNUC29543 zone)

EMBL: CP001044.PE397

CP001044.PE397       Location/Qualifiers
FT   CDS             complement(455490..456011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3519"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72666"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN3"
FT                   /protein_id="ACC72666.1"
FT                   /translation="MIGLTSRHAETQDNSVAGTSTARQDSDEFVRMRQQVAAADREYDR
FT                   EAAAAKKVYDPRRRKRRRSATPRSRSPITARASRGRLADVAVVAAHYAAAGANERIMNF
FT                   PSRVARQCLTFKGKPPVVAALSVASTTSVYAQKNSCATDTAMNAFGDAAVKDRRYSLNG
FT                   VKTETTMDRE"
     MIGLTSRHAE TQDNSVAGTS TARQDSDEFV RMRQQVAAAD REYDREAAAA KKVYDPRRRK        60
     RRRSATPRSR SPITARASRG RLADVAVVAA HYAAAGANER IMNFPSRVAR QCLTFKGKPP       120
     VVAALSVAST TSVYAQKNSC ATDTAMNAFG DAAVKDRRYS LNGVKTETTM DRE              173
//

If you have problems or comments...

PBIL Back to PBIL home page