(data stored in ACNUC29543 zone)

EMBL: CP001044.PE403

CP001044.PE403       Location/Qualifiers
FT   CDS             complement(466108..466848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3528"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: reu:Reut_A3378
FT                   OmpW"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3528"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72672"
FT                   /db_xref="GOA:B2JLN9"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN9"
FT                   /protein_id="ACC72672.1"
FT                   /translation="MRNYRKNVRPAVMAGLICSAALAGNANAQSAGSFTLATGWLYVAP
FT                   QGHATPLTVESVGGMPVNQQLTGTGAHASSTNTLGITTEYYVTDNIGIATLFGLPLTVN
FT                   LDGDGTLSKYGTLGTTRPMPPAIEVRYHLFDAQTKFRPYVGLGVNYTWFTQVRATNHQF
FT                   ITDSVGPGGSIHATLSASWNPVFEVGASYMFAKHWSVGASVGYMPLKTHMTIYGQTATG
FT                   TQIVSKSTLRIEPINVFVNVAYTF"
     MRNYRKNVRP AVMAGLICSA ALAGNANAQS AGSFTLATGW LYVAPQGHAT PLTVESVGGM        60
     PVNQQLTGTG AHASSTNTLG ITTEYYVTDN IGIATLFGLP LTVNLDGDGT LSKYGTLGTT       120
     RPMPPAIEVR YHLFDAQTKF RPYVGLGVNY TWFTQVRATN HQFITDSVGP GGSIHATLSA       180
     SWNPVFEVGA SYMFAKHWSV GASVGYMPLK THMTIYGQTA TGTQIVSKST LRIEPINVFV       240
     NVAYTF                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page