(data stored in ACNUC29543 zone)

EMBL: CP001044.PE407

CP001044.PE407       Location/Qualifiers
FT   CDS             complement(470460..471530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3532"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bch:Bcen2424_5775
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3532"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72676"
FT                   /db_xref="GOA:B2JLP3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLP3"
FT                   /protein_id="ACC72676.1"
FT                   /translation="MKLTSAQPARHPHPTAKACALAYLIFERPDLEQAERFLNDFGLQT
FT                   VSRGEGLLLLRGTGASHFCYVVRKASKAAFVGFGLQVATRSELEALATLPGASEVEQSA
FT                   LTGGGYVVRLTDPSGFRVDAIWGQTAASALPHRLPLPFNSVDATVRINDTQRPPTHAPE
FT                   VIRLGHVVLELADYQATCAWYTRHFGFIPSDVQVLPDGSPAVAFMRLDLDDTPADHHTL
FT                   ALAQGFVATYSHSAYELVDADAVGMGQRVLRENGWNHAWGIGRHILGSQIFDYWQDPWG
FT                   DKHEHYCDGDLFTSDEPTGIHAVSREAMAQWGPTMPRSFTKPRLTPASLVALFKNLRRS
FT                   PDLTLNKLRTLAKLFA"
     MKLTSAQPAR HPHPTAKACA LAYLIFERPD LEQAERFLND FGLQTVSRGE GLLLLRGTGA        60
     SHFCYVVRKA SKAAFVGFGL QVATRSELEA LATLPGASEV EQSALTGGGY VVRLTDPSGF       120
     RVDAIWGQTA ASALPHRLPL PFNSVDATVR INDTQRPPTH APEVIRLGHV VLELADYQAT       180
     CAWYTRHFGF IPSDVQVLPD GSPAVAFMRL DLDDTPADHH TLALAQGFVA TYSHSAYELV       240
     DADAVGMGQR VLRENGWNHA WGIGRHILGS QIFDYWQDPW GDKHEHYCDG DLFTSDEPTG       300
     IHAVSREAMA QWGPTMPRSF TKPRLTPASL VALFKNLRRS PDLTLNKLRT LAKLFA           356
//

If you have problems or comments...

PBIL Back to PBIL home page