(data stored in ACNUC29543 zone)

EMBL: CP001044.PE408

CP001044.PE408       Location/Qualifiers
FT   CDS             471994..472707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3533"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bch:Bcen2424_5773 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3533"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72677"
FT                   /db_xref="GOA:B2JLP4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLP4"
FT                   /protein_id="ACC72677.1"
FT                   /translation="MAAPVTPAPVAEEREPRGARRKRETRARLLDAALRLMAEKGMEGV
FT                   AINEITEAADVGFGSFYNHFESKEAIYTTLVDNVFEEFADMLDRLASGIADPAEVISVS
FT                   VRHTVLRARRDPVWGRFLIREGFSAQMISRGLGQRLLRDIGNGIAAKRFVVADPFIGFL
FT                   AVGGTVLSAIAAELNFVAPGAPAAGVLEEYGFSGEHFPERTAAMLLQTLGLKRAEAEKV
FT                   AARPLPVVEEAAEER"
     MAAPVTPAPV AEEREPRGAR RKRETRARLL DAALRLMAEK GMEGVAINEI TEAADVGFGS        60
     FYNHFESKEA IYTTLVDNVF EEFADMLDRL ASGIADPAEV ISVSVRHTVL RARRDPVWGR       120
     FLIREGFSAQ MISRGLGQRL LRDIGNGIAA KRFVVADPFI GFLAVGGTVL SAIAAELNFV       180
     APGAPAAGVL EEYGFSGEHF PERTAAMLLQ TLGLKRAEAE KVAARPLPVV EEAAEER          237
//

If you have problems or comments...

PBIL Back to PBIL home page