(data stored in ACNUC29543 zone)

EMBL: CP001044.PE409

CP001044.PE409       Location/Qualifiers
FT   CDS             complement(473097..473858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3534"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   bxe:Bxe_A2126 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3534"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72678"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLP5"
FT                   /protein_id="ACC72678.1"
FT                   /translation="MMLMQFRSMRRVARALMGVGLATLAACASPPTRFYTLGIDAQPTI
FT                   AVSTASPSFRIDVRPVKVPAAVARSQLVVQINAAQVQVLEDDRWVSSLPDEIRAALIAG
FT                   VSQQAGAPAAKTLVPGEDVPVYEVTVDIQRFESWPGSHVLVDGVWTVSRSTSADTLTCH
FT                   SVVSEPVSGGYQAVAGGHRRAMSVVAAQIAKAIRAFPASGGDSPSRPDGASGTAGKRGE
FT                   RGERGKRALSCPHATDSVQTAADRTAPRVDE"
     MMLMQFRSMR RVARALMGVG LATLAACASP PTRFYTLGID AQPTIAVSTA SPSFRIDVRP        60
     VKVPAAVARS QLVVQINAAQ VQVLEDDRWV SSLPDEIRAA LIAGVSQQAG APAAKTLVPG       120
     EDVPVYEVTV DIQRFESWPG SHVLVDGVWT VSRSTSADTL TCHSVVSEPV SGGYQAVAGG       180
     HRRAMSVVAA QIAKAIRAFP ASGGDSPSRP DGASGTAGKR GERGERGKRA LSCPHATDSV       240
     QTAADRTAPR VDE                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page