(data stored in ACNUC29543 zone)

EMBL: CP001044.PE411

CP001044.PE411       Location/Qualifiers
FT   CDS             complement(475508..476857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3536"
FT                   /product="integral membrane protein, PqiA family"
FT                   /note="TIGRFAM: integral membrane protein, PqiA family;
FT                   PFAM: Paraquat-inducible protein A; KEGG: rme:Rmet_4089
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3536"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72680"
FT                   /db_xref="GOA:B2JLP7"
FT                   /db_xref="InterPro:IPR005219"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLP7"
FT                   /protein_id="ACC72680.1"
FT                   /translation="MSQMEYRQLIACHECDLLFRKPSSVKGRRAACSRCGASLTALPGS
FT                   GLSLDPICAVTLAALVTFCIAQCFPLIALRANGMTSEATLFGAVRSLWSDNMCVVAAMV
FT                   FCSSILFPLIELLALSYLLVPLRMGNVPPRFNSTLRLIQVVRPWGMVEVFMLGALVTIV
FT                   KMASMAEVIPGPGLFALAALTVLLAVVTSFDPSRLWAVRDGIRSPRMAGIRWSRASGHD
FT                   GRFMKPLRARVAGSSAVITAQRAGLVGCHACGLVQTRIEQQTHHRCARCQHVLHERRPD
FT                   GLTRTVSLLLAAALAYIPANLLPIMHASTLGRSEDDTILGGVAYFWTSGDWPLAVVVFI
FT                   ASVLVPMLKLVALTLLTVVARRGSDWRARERAGLYRVVERIGRWSMLDVFVVALTVTLV
FT                   HFGSFAVITAGPAALAFGSVVILTMLASQQFDPRLIWDNAGQRIRPDDER"
     MSQMEYRQLI ACHECDLLFR KPSSVKGRRA ACSRCGASLT ALPGSGLSLD PICAVTLAAL        60
     VTFCIAQCFP LIALRANGMT SEATLFGAVR SLWSDNMCVV AAMVFCSSIL FPLIELLALS       120
     YLLVPLRMGN VPPRFNSTLR LIQVVRPWGM VEVFMLGALV TIVKMASMAE VIPGPGLFAL       180
     AALTVLLAVV TSFDPSRLWA VRDGIRSPRM AGIRWSRASG HDGRFMKPLR ARVAGSSAVI       240
     TAQRAGLVGC HACGLVQTRI EQQTHHRCAR CQHVLHERRP DGLTRTVSLL LAAALAYIPA       300
     NLLPIMHAST LGRSEDDTIL GGVAYFWTSG DWPLAVVVFI ASVLVPMLKL VALTLLTVVA       360
     RRGSDWRARE RAGLYRVVER IGRWSMLDVF VVALTVTLVH FGSFAVITAG PAALAFGSVV       420
     ILTMLASQQF DPRLIWDNAG QRIRPDDER                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page