(data stored in ACNUC29543 zone)

EMBL: CP001044.PE414

CP001044.PE414       Location/Qualifiers
FT   CDS             complement(481618..482796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3539"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bvi:Bcep1808_1683 efflux transporter, RND family, MFP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3539"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72683"
FT                   /db_xref="GOA:B2JLZ3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLZ3"
FT                   /protein_id="ACC72683.1"
FT                   /translation="MNIVKHSGPVAPKLSRSLLSFLSQSTHRVPVVIAACSAVLLCACH
FT                   QREAVVPQAKPVVARAVRPDGRVAGSSLPAQVQARYSTPLSFRVGGKVIERRVRIGDTV
FT                   KAGQTVALLDPTDLQNNLVNARAQLDAAEHRLVFAKQQLDRDEAQSRANLIAASQLEQT
FT                   QDAYANAVAQRTSALAQMALASDHLRYATLTADHDGVITSEDVDTGQNVQATQAVYHLD
FT                   WTGDVDIVCDAPERTVNSLTVGSKARVTLPALPGKVLEARVREVSAAADPESRTWRVKL
FT                   TLAAPSPEVRLGMTANVVFDVAADGAAGEAFTVPVTALFHQGEKPAVWVVRNGSDTLEL
FT                   RPVTIQRYDERTVSLGSGLHDGDRVVLQGVHAVSSGQHVQVVPPLHSEDSPT"
     MNIVKHSGPV APKLSRSLLS FLSQSTHRVP VVIAACSAVL LCACHQREAV VPQAKPVVAR        60
     AVRPDGRVAG SSLPAQVQAR YSTPLSFRVG GKVIERRVRI GDTVKAGQTV ALLDPTDLQN       120
     NLVNARAQLD AAEHRLVFAK QQLDRDEAQS RANLIAASQL EQTQDAYANA VAQRTSALAQ       180
     MALASDHLRY ATLTADHDGV ITSEDVDTGQ NVQATQAVYH LDWTGDVDIV CDAPERTVNS       240
     LTVGSKARVT LPALPGKVLE ARVREVSAAA DPESRTWRVK LTLAAPSPEV RLGMTANVVF       300
     DVAADGAAGE AFTVPVTALF HQGEKPAVWV VRNGSDTLEL RPVTIQRYDE RTVSLGSGLH       360
     DGDRVVLQGV HAVSSGQHVQ VVPPLHSEDS PT                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page