(data stored in ACNUC29543 zone)

EMBL: CP001044.PE418

CP001044.PE418       Location/Qualifiers
FT   CDS             complement(491019..492134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3547"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bam:Bamb_6578 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3547"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72687"
FT                   /db_xref="GOA:B2JLZ7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLZ7"
FT                   /protein_id="ACC72687.1"
FT                   /translation="MFSRRLATSALACALPFALAACGEKTLSDPRIEAPLVRMSVVQRA
FT                   VPASRSFTGTIAARVQSDLGFRVSGKVLERLVDAGQTVKRGQPLMRLDPVDLKLAAQAR
FT                   QEAVAAARARAQQTAQDEERYRDLRGTGAISASAYDQAKAAADAASAQLNAAEADADVA
FT                   RNATGYAGLVADGDGVVMETLAEPGQVVSAGQPVVRLAHAGHREAVIQLPETLRPAIGS
FT                   VAQATLFGNSGLSVPATLRQLSDTADSHTRTFEARYVLQGALADAPLGATVTIEIPDAR
FT                   VALQDGLQVPIGAVLDAGKGPGVWVINGEPAKVAWRPVTVLHLDDDSARVSGTLKQGER
FT                   VVALGAQLLREGEPVRVSGQAVAMASEGARP"
     MFSRRLATSA LACALPFALA ACGEKTLSDP RIEAPLVRMS VVQRAVPASR SFTGTIAARV        60
     QSDLGFRVSG KVLERLVDAG QTVKRGQPLM RLDPVDLKLA AQARQEAVAA ARARAQQTAQ       120
     DEERYRDLRG TGAISASAYD QAKAAADAAS AQLNAAEADA DVARNATGYA GLVADGDGVV       180
     METLAEPGQV VSAGQPVVRL AHAGHREAVI QLPETLRPAI GSVAQATLFG NSGLSVPATL       240
     RQLSDTADSH TRTFEARYVL QGALADAPLG ATVTIEIPDA RVALQDGLQV PIGAVLDAGK       300
     GPGVWVINGE PAKVAWRPVT VLHLDDDSAR VSGTLKQGER VVALGAQLLR EGEPVRVSGQ       360
     AVAMASEGAR P                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page