(data stored in ACNUC29543 zone)

EMBL: CP001044.PE42

CP001044.PE42        Location/Qualifiers
FT   CDS             39178..40575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3143"
FT                   /product="precorrin-3B synthase"
FT                   /note="TIGRFAM: precorrin-3B synthase; PFAM:
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; nitrite and sulphite reductase
FT                   4Fe-4S region; KEGG: bxe:Bxe_B1245 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3143"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72311"
FT                   /db_xref="GOA:B2JRI4"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR012798"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRI4"
FT                   /protein_id="ACC72311.1"
FT                   /translation="MNQAFHSSNAFPLRPSACPGLLRIVPALDGGICRVKLQRGELSAT
FT                   QALAIADAIDEHASGIVDLTNRANLQLRGVKRGHENALIAALLGAALGPRDAAHAHADD
FT                   VRNVMTSPAAGCDAHALYDTTALAAELLSLLQSDARCAALSPKFALLLDGGERLMMLDH
FT                   PHDIWCSALHPRDHAEPMFALGLAGCPPVLEGHPAALAAVPASELVALTRALLHTFLDL
FT                   AAPDHTRMRDLLAKQSVESVLARAERESGVRLLRGQSIQSWRREPADASRRFGAWQQRD
FT                   AHRDKQRWHIGGQPALGRVNSATLRRLALLTKEQGATLRMTPWQSVLLTDIGTANLDAT
FT                   LQTLDALGLATTTDNPLTRVIACAGSTGCVKSLADTKADAVKLAARLPDNTRVHLSGCP
FT                   RSCAAAQCAPFTMLAAQNGRYDLYHTHDPRESTGFGRLLARGLTIDEAADLLNASAAPP
FT                   FDEPFDA"
     MNQAFHSSNA FPLRPSACPG LLRIVPALDG GICRVKLQRG ELSATQALAI ADAIDEHASG        60
     IVDLTNRANL QLRGVKRGHE NALIAALLGA ALGPRDAAHA HADDVRNVMT SPAAGCDAHA       120
     LYDTTALAAE LLSLLQSDAR CAALSPKFAL LLDGGERLMM LDHPHDIWCS ALHPRDHAEP       180
     MFALGLAGCP PVLEGHPAAL AAVPASELVA LTRALLHTFL DLAAPDHTRM RDLLAKQSVE       240
     SVLARAERES GVRLLRGQSI QSWRREPADA SRRFGAWQQR DAHRDKQRWH IGGQPALGRV       300
     NSATLRRLAL LTKEQGATLR MTPWQSVLLT DIGTANLDAT LQTLDALGLA TTTDNPLTRV       360
     IACAGSTGCV KSLADTKADA VKLAARLPDN TRVHLSGCPR SCAAAQCAPF TMLAAQNGRY       420
     DLYHTHDPRE STGFGRLLAR GLTIDEAADL LNASAAPPFD EPFDA                       465
//

If you have problems or comments...

PBIL Back to PBIL home page