(data stored in ACNUC29543 zone)

EMBL: CP001044.PE421

CP001044.PE421       Location/Qualifiers
FT   CDS             complement(494485..495207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3550"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: reu:Reut_C6137 NAD-dependent
FT                   epimerase/dehydratase:short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3550"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72690"
FT                   /db_xref="GOA:B2JM00"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM00"
FT                   /protein_id="ACC72690.1"
FT                   /translation="MFKRTFLVTGASKGIGRALSNRLAADGHQVVGLARGADDSSFPGI
FT                   LVSVDLTDRNATARALAGLAERYAFDGVVNNAGFVRLAGVEAIDLDDLEASFRHNLTSA
FT                   VQTVQALLPGMRNRGWGRIVNLSSLVVLGVANRTAYAAAKAAMMSFTRTWALELAQTGV
FT                   TVNSVAPGPTETELFRQNTPVGGEAEQRFLSLVPMKRFGKPDELAAALAFFLSEDAGFI
FT                   TGQTLFVDGGASVGKAAF"
     MFKRTFLVTG ASKGIGRALS NRLAADGHQV VGLARGADDS SFPGILVSVD LTDRNATARA        60
     LAGLAERYAF DGVVNNAGFV RLAGVEAIDL DDLEASFRHN LTSAVQTVQA LLPGMRNRGW       120
     GRIVNLSSLV VLGVANRTAY AAAKAAMMSF TRTWALELAQ TGVTVNSVAP GPTETELFRQ       180
     NTPVGGEAEQ RFLSLVPMKR FGKPDELAAA LAFFLSEDAG FITGQTLFVD GGASVGKAAF       240
//

If you have problems or comments...

PBIL Back to PBIL home page