(data stored in ACNUC29543 zone)

EMBL: CP001044.PE425

CP001044.PE425       Location/Qualifiers
FT   CDS             498069..498524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3554"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bam:Bamb_6384 alkylhydroperoxidase like protein, AhpD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3554"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72694"
FT                   /db_xref="GOA:B2JM04"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM04"
FT                   /protein_id="ACC72694.1"
FT                   /translation="MSKRLDYTQIAPAGVKALGGVYGYVLQSGLSPVLVDLVYLRVSQI
FT                   NNCAYCLDMHTRDLLKKGVKVEKLALVQAWREAGHLFDDRERAALAWAESVTLVAQTGV
FT                   PDEAYDAARAVFNDRELVDLTIAISLMNTYNRMAISFRNTPQAVMET"
     MSKRLDYTQI APAGVKALGG VYGYVLQSGL SPVLVDLVYL RVSQINNCAY CLDMHTRDLL        60
     KKGVKVEKLA LVQAWREAGH LFDDRERAAL AWAESVTLVA QTGVPDEAYD AARAVFNDRE       120
     LVDLTIAISL MNTYNRMAIS FRNTPQAVME T                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page