(data stored in ACNUC29543 zone)

EMBL: CP001044.PE426

CP001044.PE426       Location/Qualifiers
FT   CDS             499019..499792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3555"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: reu:Reut_C6131 metal-dependent
FT                   phosphohydrolase, HD subdomain; TIGRFAM: metal dependent
FT                   phophohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3555"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72695"
FT                   /db_xref="GOA:B2JM05"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM05"
FT                   /protein_id="ACC72695.1"
FT                   /translation="MKIARFVSMACAVLLILVLGFVQTSNLRAAGRAPAPDHQSSDTAD
FT                   RTPNIAIPDSKLARDAARYIRDSEGEFLFEHSTRVYCWAALTAQRNGLPYDPELLYVAA
FT                   MFHDYGLTENYAQSHLRYEVDGANAARQFLRSHGVSEATSEQVWLAIALHTTNGIPAQV
FT                   SPLAALVAQGANMDLVGAGYDDFTAEQRDAIEMAYPHPQDFAEVFMRTLYDSLKHRPET
FT                   TQGTGLADVMAYEDPHFVRRDFSALMRNSHWAARK"
     MKIARFVSMA CAVLLILVLG FVQTSNLRAA GRAPAPDHQS SDTADRTPNI AIPDSKLARD        60
     AARYIRDSEG EFLFEHSTRV YCWAALTAQR NGLPYDPELL YVAAMFHDYG LTENYAQSHL       120
     RYEVDGANAA RQFLRSHGVS EATSEQVWLA IALHTTNGIP AQVSPLAALV AQGANMDLVG       180
     AGYDDFTAEQ RDAIEMAYPH PQDFAEVFMR TLYDSLKHRP ETTQGTGLAD VMAYEDPHFV       240
     RRDFSALMRN SHWAARK                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page