(data stored in ACNUC29543 zone)

EMBL: CP001044.PE429

CP001044.PE429       Location/Qualifiers
FT   CDS             complement(502917..504929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3559"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; phosphoribosylglycinamide synthetase;
FT                   Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; KEGG: bxe:Bxe_B0963
FT                   putative biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3559"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72698"
FT                   /db_xref="GOA:B2JM08"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM08"
FT                   /protein_id="ACC72698.1"
FT                   /translation="MFNKILIANRGEIACRVAATCKRLGITSVAVYSDADANAKHVAAC
FT                   DEAVHIGGSTAAQSYLRVERIIQAAIATGAQAVHPGYGFLSENEDFAHACEKAGIAFIG
FT                   PPVEAIAAMGSKAAAKALMHSAAVPLVPGYHGDDQSADLLHRQADQIAYPVLLKASAGG
FT                   GGKGMRVVERTEDFAAALASCKREAASSFGNDRVLIEKYLTRPRHVEVQVFADKHGGAV
FT                   YLFDRDCSVQRRHQKVLEEAPAPGLQPHVRRAMGEAAVAAARAVNYVGAGTVEFIMTEG
FT                   GEFYFMEMNTRLQVEHPVTEMVTGLDLVEWQLRVAAGEPLPLAQDQLRVEGHAIEARIY
FT                   AEHPARGFLPSTGTLKHLRMPEGVEFTLGVGGERAPVRIDSGVREGDTITPFYDPMIAK
FT                   LIVHGASREEALKRMSQALRGCEVVGPHTNVEFLQRIVTSVPFSTGDLDTGLIERHHAA
FT                   LFAPVAKPFVEALALACGALLTREGGVAHGASPWDALSHWRLNSGYMQTLNWRDVETES
FT                   AFSVLFSRDGDTQTLTHEGRTEPFKWWTGAGRHEYGATIGDAHVTGRVFIDGDTFHVFC
FT                   RGEALAFEWQNLLAHAADAEHGEGRLTAPMPGKVIAVLVEQGAVVEKGQPLIVMEAMKM
FT                   EHTIGAPAAGKVAELLYGVGDQVADGAQLLVLDVE"
     MFNKILIANR GEIACRVAAT CKRLGITSVA VYSDADANAK HVAACDEAVH IGGSTAAQSY        60
     LRVERIIQAA IATGAQAVHP GYGFLSENED FAHACEKAGI AFIGPPVEAI AAMGSKAAAK       120
     ALMHSAAVPL VPGYHGDDQS ADLLHRQADQ IAYPVLLKAS AGGGGKGMRV VERTEDFAAA       180
     LASCKREAAS SFGNDRVLIE KYLTRPRHVE VQVFADKHGG AVYLFDRDCS VQRRHQKVLE       240
     EAPAPGLQPH VRRAMGEAAV AAARAVNYVG AGTVEFIMTE GGEFYFMEMN TRLQVEHPVT       300
     EMVTGLDLVE WQLRVAAGEP LPLAQDQLRV EGHAIEARIY AEHPARGFLP STGTLKHLRM       360
     PEGVEFTLGV GGERAPVRID SGVREGDTIT PFYDPMIAKL IVHGASREEA LKRMSQALRG       420
     CEVVGPHTNV EFLQRIVTSV PFSTGDLDTG LIERHHAALF APVAKPFVEA LALACGALLT       480
     REGGVAHGAS PWDALSHWRL NSGYMQTLNW RDVETESAFS VLFSRDGDTQ TLTHEGRTEP       540
     FKWWTGAGRH EYGATIGDAH VTGRVFIDGD TFHVFCRGEA LAFEWQNLLA HAADAEHGEG       600
     RLTAPMPGKV IAVLVEQGAV VEKGQPLIVM EAMKMEHTIG APAAGKVAEL LYGVGDQVAD       660
     GAQLLVLDVE                                                              670
//

If you have problems or comments...

PBIL Back to PBIL home page