(data stored in ACNUC29543 zone)

EMBL: CP001044.PE433

CP001044.PE433       Location/Qualifiers
FT   CDS             508908..509672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3563"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_B0959
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3563"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72702"
FT                   /db_xref="GOA:B2JM12"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013570"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM12"
FT                   /protein_id="ACC72702.1"
FT                   /translation="MMGVARADGPASRRQPAGRKSQQRVKEILQAGRDVFSEKGYERAT
FT                   TAEIAQRLGISEATVFSYFRGKRELCARVIGDWYDEIIEAIESGLPRDGSIRQQFAFIV
FT                   RTHLRLMLVNGTGLCALVLSEGRTRQHELSEELTGLQRRYTAPLMRVLSQGQQTGQIRS
FT                   DIPLRLLRSLVFGPMEHVLWDAALGNRRTDIDATADRLIDVLWSALQPPDASLDALMQF
FT                   RQEVSEATRRLAEAEAAHKQRAPRLANTNDDA"
     MMGVARADGP ASRRQPAGRK SQQRVKEILQ AGRDVFSEKG YERATTAEIA QRLGISEATV        60
     FSYFRGKREL CARVIGDWYD EIIEAIESGL PRDGSIRQQF AFIVRTHLRL MLVNGTGLCA       120
     LVLSEGRTRQ HELSEELTGL QRRYTAPLMR VLSQGQQTGQ IRSDIPLRLL RSLVFGPMEH       180
     VLWDAALGNR RTDIDATADR LIDVLWSALQ PPDASLDALM QFRQEVSEAT RRLAEAEAAH       240
     KQRAPRLANT NDDA                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page