(data stored in ACNUC29543 zone)

EMBL: CP001044.PE434

CP001044.PE434       Location/Qualifiers
FT   CDS             509976..510389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3564"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: bxe:Bxe_B1321
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3564"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72703"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM13"
FT                   /protein_id="ACC72703.1"
FT                   /translation="MQHAINRTCRIAFASMLLVGAWTSVSTAAYAQGAPQSITERHTEV
FT                   THTGSGFRASKLSGTTVYNRDKDKIGTIDDVIVSPSDQHAFAILSVGGFLGMGKHYVAV
FT                   PLGDLQITAKAVTMPDATKSSLEALPEFKYAPD"
     MQHAINRTCR IAFASMLLVG AWTSVSTAAY AQGAPQSITE RHTEVTHTGS GFRASKLSGT        60
     TVYNRDKDKI GTIDDVIVSP SDQHAFAILS VGGFLGMGKH YVAVPLGDLQ ITAKAVTMPD       120
     ATKSSLEALP EFKYAPD                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page