(data stored in ACNUC29543 zone)

EMBL: CP001044.PE438

CP001044.PE438       Location/Qualifiers
FT   CDS             complement(513657..514001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3568"
FT                   /product="transcriptional regulator, XRE family with cupin
FT                   sensor domain"
FT                   /note="KEGG: bxe:Bxe_B0944 transcriptional regulator, XRE
FT                   family with cupin sensor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3568"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72707"
FT                   /db_xref="GOA:B2JM17"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM17"
FT                   /protein_id="ACC72707.1"
FT                   /translation="MTFSLCITFRFRECIDIDRGAARLQYICKKHRLSQRELAKRAGVT
FT                   NGTISMSLAEFFTFEVEANRTVVSRRAEMPNLGNEQIDFYLAGASVKGRNMGIMREVRH
FT                   RLMRVPDELR"
     MTFSLCITFR FRECIDIDRG AARLQYICKK HRLSQRELAK RAGVTNGTIS MSLAEFFTFE        60
     VEANRTVVSR RAEMPNLGNE QIDFYLAGAS VKGRNMGIMR EVRHRLMRVP DELR             114
//

If you have problems or comments...

PBIL Back to PBIL home page