(data stored in ACNUC29543 zone)

EMBL: CP001044.PE439

CP001044.PE439       Location/Qualifiers
FT   CDS             514384..514608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3569"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C7564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3569"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72708"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM18"
FT                   /protein_id="ACC72708.1"
FT                   /translation="MRVRGPLVWWDRSQFARCLRADNAIADGSNGRLAFRRFLSVFTTL
FT                   SRRSVRRHNAISARASIAVHTDEVASLLP"
     MRVRGPLVWW DRSQFARCLR ADNAIADGSN GRLAFRRFLS VFTTLSRRSV RRHNAISARA        60
     SIAVHTDEVA SLLP                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page