(data stored in ACNUC29543 zone)

EMBL: CP001044.PE442

CP001044.PE442       Location/Qualifiers
FT   CDS             515735..517069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3572"
FT                   /product="Glutamate--putrescine ligase"
FT                   /EC_number="6.3.1.11"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   bxe:Bxe_B0942 glutamate--ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3572"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72711"
FT                   /db_xref="GOA:B2JM21"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM21"
FT                   /protein_id="ACC72711.1"
FT                   /translation="MQEIDEFLKKHHITEIEAIIPDMAGIARGKIIPRSKFESGESMRL
FT                   PQAVMIQTVTGEYPDDGTLTGVTDPDMVCVPDPSTIRIIPWAVDPTAQVIHDCVHFDGT
FT                   PVAISPRRVLRRVLDLYKAKGWKPVIAPELEFYLVDMNKDPDLPLCPPVGRTGRAETGR
FT                   QAYSIEAVNEFDPLFEDIYEYCDIQELEVDTLIHEVGAAQMEINFLHGDPLKLADQVFL
FT                   FKRTVREAALRHHMYATFMAKPMEGEPGSAMHVHQSLVDEETGQNLFTGSDGKPTDVFN
FT                   QYLAGLQKYTPALMPIFAPYINSYRRLSRFMAAPINVQWGYDNRTVGFRIPHSGPQARR
FT                   IENRIPGVDCNPYLAIAGTLAAGYLGITQRLTPTEPLSSDGYELPYQLPRNLEEGLTLM
FT                   SACEPLAEIMGEQFVKAYLALKETEYEAFFRVISSWERRHLLLHV"
     MQEIDEFLKK HHITEIEAII PDMAGIARGK IIPRSKFESG ESMRLPQAVM IQTVTGEYPD        60
     DGTLTGVTDP DMVCVPDPST IRIIPWAVDP TAQVIHDCVH FDGTPVAISP RRVLRRVLDL       120
     YKAKGWKPVI APELEFYLVD MNKDPDLPLC PPVGRTGRAE TGRQAYSIEA VNEFDPLFED       180
     IYEYCDIQEL EVDTLIHEVG AAQMEINFLH GDPLKLADQV FLFKRTVREA ALRHHMYATF       240
     MAKPMEGEPG SAMHVHQSLV DEETGQNLFT GSDGKPTDVF NQYLAGLQKY TPALMPIFAP       300
     YINSYRRLSR FMAAPINVQW GYDNRTVGFR IPHSGPQARR IENRIPGVDC NPYLAIAGTL       360
     AAGYLGITQR LTPTEPLSSD GYELPYQLPR NLEEGLTLMS ACEPLAEIMG EQFVKAYLAL       420
     KETEYEAFFR VISSWERRHL LLHV                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page